DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and ctrl

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:268 Identity:103/268 - (38%)
Similarity:140/268 - (52%) Gaps:33/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDG--RIVGGSATTISSFPWQISLQRS-GSHSCGGSIYS 62
            ||.|:...:.|...||..|| .:.|.:.|  |||.|......|:|||:|||:| |.|.||||:.:
Zfish     1 MLWIISCFALVASTLGCGVP-AIKPVISGYNRIVNGENAVSGSWPWQVSLQQSNGFHFCGGSLIN 64

  Fly    63 ANIIVTAAHCLQSVSASVLQVRAGSTYWSSG----GVVAKVSSFKN------HEGYNANTMVNDI 117
            ...:||||||         :|:||..|...|    |..|:....|:      |..||:....|||
Zfish    65 QYWVVTAAHC---------RVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDI 120

  Fly   118 AVIRLSSSLSFSSSIKAISLATYNPA--NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC 180
            .:::|||....:|.|..:.||..:.:  :|.....:|||  .:||:|.|..||...:.::|.:||
Zfish   121 TLLKLSSPAQLTSRISPVCLAASSTSIPSGTRCVTTGWG--KTGSTSSPRILQQTALPLLSPAQC 183

  Fly   181 ASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYAD 241
              ..|...::|.:.||||.|||..:||||||||||  |.|.  .||:||||........|.|||.
Zfish   184 --KQYWGQNRITDAMICAGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTSDCNVRTPAVYAR 246

  Fly   242 VAVLRSWV 249
            |:.||.|:
Zfish   247 VSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 92/235 (39%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 92/235 (39%)
Tryp_SPc 32..257 CDD:238113 92/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.