DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP012778

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_001230340.2 Gene:AgaP_AGAP012778 / 4397620 VectorBaseID:AGAP012778 Length:276 Species:Anopheles gambiae


Alignment Length:257 Identity:70/257 - (27%)
Similarity:115/257 - (44%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLP---QLDG---RIVGGSATTISSFPWQIS----LQRSGSHSCGGSIYSANIIVTAAHCLQSVS 77
            |||   |.|.   ||:||||.|..|  |.::    :..:.|:.|||::.....::|||||:.:..
Mosquito    29 LLPLAVQADAGSQRIIGGSAVTAPS--WMVAVGEVVNGNWSNFCGGTLIDKQWVLTAAHCVANAQ 91

  Fly    78 ASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVN----------DIAVIRLSSSLSFSSSI 132
            :..::|..|.:..|.....:||.....|..|..|.:.|          |:|::.|::.::.:..:
Mosquito    92 SGPMEVAIGVSDLSRPHTRSKVDQVLMHPEYYVNLLSNLGYRETPYSSDVALLHLATPVTQAPIV 156

  Fly   133 KA--ISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTM 195
            .|  .:..|:........|:...|.....:.|.|   |.:.|::..:.:   ..|.||......:
Mosquito   157 MADITTKDTWQWNTTMLHAIGYGGINPDATKSSP---QLLAVDLAYRGE---RDYWYGDPTTTHI 215

  Fly   196 ICAAASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVSTANSI 256
            .....:|:|.|:|||||||..||.||||.|:| :.|| :...|.|........|:|.....:
Mosquito   216 FAGKLAGQDTCKGDSGGPLTYGGKLVGVTSYGAFPCA-TGSAGGYTYAPAFSDWIVGQQQGV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 63/235 (27%)
AgaP_AGAP012778XP_001230340.2 Tryp_SPc 42..269 CDD:214473 63/235 (27%)
Tryp_SPc 43..269 CDD:238113 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.