DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP012842

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_001230353.1 Gene:AgaP_AGAP012842 / 4397614 VectorBaseID:AGAP012842 Length:110 Species:Anopheles gambiae


Alignment Length:106 Identity:46/106 - (43%)
Similarity:62/106 - (58%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGG 212
            |||||...|.:.| ...|:..||..|:|.:|..:.......|.:.|.||.  ..|:|.|:.||||
Mosquito     4 VSGWGLTLSDADS-NDVLRATNVPTVNQQECNKAYQSMYGGITDQMFCAGYKQGGQDTCRQDSGG 67

  Fly   213 PLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTA 253
            |.|:.|.|:||:|||:.||.:.||||||.||..|.|:.:|:
Mosquito    68 PFVAEGKLIGVISWGHECALAGYPGVYARVASARDWIRATS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 44/100 (44%)
AgaP_AGAP012842XP_001230353.1 Tryp_SPc <1..107 CDD:238113 45/103 (44%)
Tryp_SPc <1..104 CDD:214473 44/100 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.