DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and intr

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:259 Identity:57/259 - (22%)
Similarity:99/259 - (38%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVVCALGGTVPEGL--LP-QLDGRIVGGSATT-----ISSFPWQISLQRSGSHSCGGSIYSAN 64
            :||...:.|...|..|  :| :::..:..|.|||     :..|..:|..:  ....|.|::.|..
  Fly    59 ISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYE--NKVICSGALISTR 121

  Fly    65 IIVTAAHCL-----QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSS 124
            :::|:|.|.     |....|.....:.|..:|...::...              :.|:|::.|.:
  Fly   122 LVLTSALCFPRTLRQPPPRSYKLQASRSRIYSVANLITGA--------------IEDMALLLLHA 172

  Fly   125 SLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQ--LQYVNVNIVSQSQCASSTYGY 187
            .|. ...:..|.|.. :|..           ::...:...||  |:::...::..|.|..| |..
  Fly   173 PLE-DPFVHPIDLCE-SPLR-----------RNDNVTMYMSQQHLRFLRTKLIPNSNCKRS-YAQ 223

  Fly   188 GSQ--IRNTMICAAASGKDA-CQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPG-VYADVAVLRS 247
            ...  |..||:||..|.:.. ||...|..|:....|.||..:|..|:.....| :||||...|:
  Fly   224 DENAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKART 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 51/234 (22%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 44/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.