DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG11836

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:232 Identity:89/232 - (38%)
Similarity:132/232 - (56%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAG----STYW 90
            |||||..|.::.:||...:...|...||||:.:.:.:::||||::.:..|.::|..|    ....
  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160

  Fly    91 SSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYN--PANGASAAVSGW 153
            .|..:...|::...|:.::.:|..||||::||...:|||..||.|.|..||  || |....|.||
  Fly   161 ESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPA-GRIGTVVGW 224

  Fly   154 GTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGP-LVSG 217
            |..|.| ..:||.:..|.|.|:|.::|.:..| ..::|.::|:||.....|:|||||||| |:|.
  Fly   225 GRTSEG-GELPSIVNQVKVPIMSITECRNQRY-KSTRITSSMLCAGRPSMDSCQGDSGGPLLLSN 287

  Fly   218 GV---LVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS 251
            ||   :||:||||.||....|||||:.|:....|:.|
  Fly   288 GVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 87/228 (38%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.