DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG5255

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:259 Identity:83/259 - (32%)
Similarity:129/259 - (49%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTVPEGLLP--QLDGRIVGGSATTISSFPWQISLQ--RSGSHSCGGSIYSAN 64
            ::::|..:|........:.|.|  ....|||||........|:|||||  .||:|||||:|....
  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDER 65

  Fly    65 IIVTAAHCLQSVSASVLQV--------RAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIR 121
            .|:|||||.:...|:..:|        :.||.|:....:|       .|..|......||||::.
  Fly    66 WIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIV-------EHSNYAPRKYRNDIALLH 123

  Fly   122 LSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            |:.|:.|.::.:.:.|.......|:...::||||.|.| ..:|::||.:.||.|...||.:: :.
  Fly   124 LNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLG-GDVPARLQSLEVNYVPFEQCRAA-HD 186

  Fly   187 YGSQIRNTMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ..:::....:|. ...|:.||.||||||||..|.||.:|:||..|| ..||..:|.::....::
  Fly   187 NSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/229 (34%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 79/229 (34%)
Tryp_SPc 30..252 CDD:238113 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.