DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG17475

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:124/277 - (44%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQL----------------DGRIVGGSATTISSFPWQISLQ 49
            :::|:::|.|..|.  ..:....|.||                ..|::.|....:....:|||||
  Fly     6 VVQILVILLACTCY--KPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQ 68

  Fly    50 -RSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTM 113
             ..|.|.|||.|.....::|||||:...:.:.|:|..|:..:.....|..|.....|..||:...
  Fly    69 GMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDY 133

  Fly   114 VNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQ 177
            .||||:|||:.::.|:...:...|.|...|||....::||| |:..|.:  |..||...:..|..
  Fly   134 HNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDT--PDILQKAYLTHVVY 196

  Fly   178 SQCASSTYGYGSQIRNT-------MICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSN 234
            |.|        .:|.|.       .||. ...|:.||.|||||||...|||.|:|:|||.||. .
  Fly   197 STC--------QEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCAL-G 252

  Fly   235 YPGVYADVAVLRSWVVS 251
            .|..:|:|.....|:.|
  Fly   253 VPDSHANVYYYLEWIRS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 77/228 (34%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 77/228 (34%)
Tryp_SPc 50..269 CDD:238113 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.