DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG31265

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:263 Identity:90/263 - (34%)
Similarity:136/263 - (51%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAV---VC---ALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR-SGSHSCGGS 59
            |.::|||:..   .|   .:.|..|.|    ..|||.||....|...|:|:|||. .|||:|||:
  Fly     6 LSLLILLAVKPPNPCESKRIVGPFPAG----QSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGA 66

  Fly    60 IYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSS 124
            |.:.|.|:||.||:::...:::.|..|:..|:..|.:...:....|..|:...|.||||:::|:.
  Fly    67 ILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTE 131

  Fly   125 SLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC-----ASST 184
            :::|:...:.|:|.|.....|....::|||:..:..||: ..|..:.|.:|...:|     .:|:
  Fly   132 NITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSM-EDLHKLTVGLVPLDECYETFNRTSS 195

  Fly   185 YGYGSQIRNTMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSW 248
            .|.|.      ||. :..|:.||.|||||||||.|.|||||:||..|.. ..|.|.|:|.....|
  Fly   196 MGVGH------ICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCGV-GLPDVQANVYYYLDW 253

  Fly   249 VVS 251
            :.|
  Fly   254 IRS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/225 (35%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 79/225 (35%)
Tryp_SPc 39..257 CDD:238113 79/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.