DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG10405

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:253 Identity:97/253 - (38%)
Similarity:137/253 - (54%) Gaps:10/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVPEGLLP-QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            :|::.::..|..:..|..:| |.|.|||.|...|...||:|:||:|...|.||.||.|:|..:||
  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITA 75

  Fly    70 AHCLQSVSASVLQ--VRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLS-SSLSFS-S 130
            |||:........:  :|.||...:|||.|..|.:...|..|:...|..|:|::|.: .:||.. .
  Fly    76 AHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLG 140

  Fly   131 SIKAISLATYNPANGAS--AAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193
            .:..|.|.|...|...|  |.|||||..|:.:..:.|.|:...|..|:|.:|.:....:|. :..
  Fly   141 KVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGG-VTE 204

  Fly   194 TMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVA--VLRSWV 249
            .|.||||...||||||||||:.:.|.|:|:||||.|||...|||||..:|  .:|.|:
  Fly   205 AMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 90/226 (40%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 90/226 (40%)
Tryp_SPc 37..263 CDD:238113 90/227 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443314
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.