DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG16749

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:237 Identity:87/237 - (36%)
Similarity:122/237 - (51%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGST 88
            ||: ||:|.|:.:::..:|:.||:: .||||||||||.|...::|||||.....||.|.|:.|.|
  Fly    25 PQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVT 88

  Fly    89 YWSSGGV-VAKVSSFKNHEGYNA-NTMVNDIAVIRLSSSLSFS----SSIKAISLATYNPAN--G 145
            ..::.|. |.:|.....||.||. |...|||:::.:.....|.    :.:|...||...|..  |
  Fly    89 KINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAG 153

  Fly   146 ASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAA--SGKDACQG 208
            ....:.|||..::| ..|.|.||.|.:.:.|..:| :..:| |.......||...  .||..|.|
  Fly   154 GEGVLIGWGLNATG-GYIQSTLQEVELKVYSDEEC-TERHG-GRTDPRYHICGGVDEGGKGQCSG 215

  Fly   209 DSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAVLRSWV 249
            ||||||:..|..||:|||.. .|..:.|||||..|:....|:
  Fly   216 DSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/230 (36%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 83/230 (36%)
Tryp_SPc 30..259 CDD:238113 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.