DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG12951

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:123/262 - (46%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR-SGSHSCGGSIYSANI 65
            |.::::|:  |..:|...|.      ..|:|.|:.:::..:|:.:||:. .|||||||||.|.:.
  Fly     9 LSLIVILA--VTTVGQAAPS------ISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65

  Fly    66 IVTAAHCLQSVSASVLQVRAGSTYWSS-GGVVAKVSSFKNHEGYNANTM-VNDIAVIRLSSSLSF 128
            ::|||||.....|..|.::.|.|..|: |..|..:.....||.::.... .|||:::.:.....|
  Fly    66 VMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF 130

  Fly   129 SS------SIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            ..      .:.|::.|......|....:.|||...: ..|:...||.|::.|.|..:|.|...|.
  Fly   131 DGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDT-YGSVQDTLQEVSLKIYSDEECTSRHNGQ 194

  Fly   188 GSQIRNTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAVLRSWV 249
            ...  ...||...  .||..|.|||||||:..|..||:|||.. .|..:.|||||..|:....|:
  Fly   195 TDP--KYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

  Fly   250 VS 251
            .|
  Fly   258 KS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 74/230 (32%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/230 (32%)
Tryp_SPc 30..260 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.