DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Tmprss11c

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:240 Identity:94/240 - (39%)
Similarity:124/240 - (51%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVR-AGSTYW--S 91
            ::.||.......:|||.|||::..|.||.::.|.:.::|||||.         || |....|  |
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCF---------VRSANPKDWKVS 241

  Fly    92 SGGVVAK------VSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL--ATYNPANGASA 148
            .|.:::|      |.|...||.|:.....|||||:||||.:.:.::|:...|  ||......:..
  Rat   242 FGFLLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDV 306

  Fly   149 AVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA-ASGK-DACQGDSG 211
            .|:||||..|...| |:.||...|.|:....| :|...||..|...|:||. ..|: ||||||||
  Rat   307 VVTGWGTLKSDGDS-PNILQKGRVKIIDNKTC-NSGKAYGGVITPGMLCAGFLEGRVDACQGDSG 369

  Fly   212 GPLV---SGGV--LVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS 251
            ||||   |.|:  |.|:||||..||..|.||||..|...|.|:.|
  Rat   370 GPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 92/236 (39%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 92/236 (39%)
Tryp_SPc 187..415 CDD:238113 94/239 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.