DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk4

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:241 Identity:79/241 - (32%)
Similarity:118/241 - (48%) Gaps:27/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTIS------------SFPWQISL-QRSGSHSCGGSIYSANIIVTAAHCLQSVSASV-- 80
            :.|.||::||            |.|||.:| ....:..|.|.:.....:::||||:|. |.:|  
  Rat    20 VTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQD-SYTVGL 83

  Fly    81 -LQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPAN 144
             |....||....|..:.|.:|.  .|..||..:..||:.:|:|:.|:..|::|:.|.:|:..|..
  Rat    84 GLHNLEGSQEPGSRMLEAHLSI--QHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVASQCPTP 146

  Fly   145 GASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAA--SGKDACQ 207
            |.:..|||||...:|  .:||.||.||:::.|:..|...   |......:|.||..  ..||.|.
  Rat   147 GDTCLVSGWGRLKNG--KLPSLLQCVNLSVASEETCRLL---YDPVYHLSMFCAGGGPDRKDTCN 206

  Fly   208 GDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAVLRSWVVST 252
            ||||||:|....|.|:||.|.| |.....|.||.::....:|:.:|
  Rat   207 GDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 77/236 (33%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 72/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.