DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Mcpt1l3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038949770.1 Gene:Mcpt1l3 / 408209 RGDID:1302933 Length:270 Species:Rattus norvegicus


Alignment Length:250 Identity:66/250 - (26%)
Similarity:116/250 - (46%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLDGRIVGGSATTISSFPW----QISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQV 83
            |:|:   .||||..:...|.|:    :|:.::.....|||.:.|...::|||||    :...:.|
  Rat    37 LVPE---EIVGGVESIPHSRPYMAHLKITTEKGYVTFCGGFLISRQFVLTAAHC----NGREITV 94

  Fly    84 RAGS---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPAN- 144
            ..|:   :...|.....||.....|:.||..:.::||.:::|...:..:.::..:.|.  :|:: 
  Rat    95 TLGAHDVSKRESTQQKLKVEKQIIHKNYNFFSNIHDIMLLKLEKQVELTPAVDVVPLP--SPSDF 157

  Fly   145 ---GASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQC-ASSTYGYGSQIRNTMICAAASG-- 202
               |.....:||| |..:..:|....|:.|.:.|:....| ..|.|.|     |..:|..:.|  
  Rat   158 IDPGTMCQAAGWGQTGVTDPTSYTYTLREVELRIMDVEACKIFSDYDY-----NFQMCVGSPGRM 217

  Fly   203 KDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSW--VVSTANS 255
            :...:|||||||:..||..|:||  :|...:..|.|:..::....|  :|.:|:|
  Rat   218 RSPYEGDSGGPLLCAGVAHGIVS--HGREDAKPPAVFTRISPYVPWINIVLSASS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 61/235 (26%)
Mcpt1l3XP_038949770.1 Tryp_SPc 42..263 CDD:238113 61/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.