DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Tryx5

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:275 Identity:56/275 - (20%)
Similarity:102/275 - (37%) Gaps:53/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTVPEG------LLPQLDGRIVGGSATTISSF--PWQISLQRSGSHSCGGSI 60
            |..|||..|.:....|.:|      .||:              :|  |:...| :|....|.|::
  Rat     6 IFALLSLAVASYPEVVLKGDQDSDEYLPE--------------NFNVPYMAYL-KSSPEPCVGTL 55

  Fly    61 YSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKN-------------HEGYNANT 112
            .....::|||||     :...::|.|          ....:.||             |..::||.
  Rat    56 IDPLWVLTAAHC-----SLPTKIRLG----------VYRPNIKNEKEQIHGYSLTVVHPNFDANI 105

  Fly   113 MVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQ 177
            ..||:.:|:||...:....:..|::|........:..:..|......:.|.|..|.:.|....|.
  Rat   106 RKNDLMLIKLSYPATIDMYVGTIAIAMEPMVFNETCFIPTWTWNHYNNYSDPDTLTWTNQYSRSP 170

  Fly   178 SQCASSTYGYGSQIRNTMICAAAS--GKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA 240
            |.|.::.:....:.|..::|...|  .|.:.:..|..|.:..|.:.|::|||.....:...|.:.
  Rat   171 SDCWNTLHQQRQETRINIMCIGHSFNVKSSTKEVSAAPAICSGRVHGILSWGKAGITNGSEGFFT 235

  Fly   241 DVAVLRSWVVSTANS 255
            ::.....|::...:|
  Rat   236 EIHPYARWILRVMHS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 45/235 (19%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 44/222 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.