DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and MP1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:266 Identity:80/266 - (30%)
Similarity:123/266 - (46%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQ--ISLQRSGS---HSCGGSIYSANIIVTAAHCLQSVSA--SVLQVRAGS 87
            |:|||:.||...|||.  |...:.|:   |.||||:.:...::|||||:.::.:  .:..||.|.
  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE 201

  Fly    88 TYWSSGG----VVAKVSSFKNHEGY----------------NANTMVNDIAVIRLSSSLSFSSSI 132
              |.:..    .|.|......:|.|                |:...:||||::||...:.:|..|
  Fly   202 --WDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFI 264

  Fly   133 KAISLATY-----NPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            ..:.|.|.     |...|....|:||| |:::.:|:|..:.:   ::.|..|:|   ...|.:|.
  Fly   265 LPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAE---LDTVPTSEC---NQRYATQR 323

  Fly   192 RNT---MICA-AASGKDACQGDSGGPLV--------SGGVLVGVVSWG-YGCAYSNYPGVYADVA 243
            |..   .:|| ...|.|:|:|||||||:        |...:.||||:| ..|....:||||..|.
  Fly   324 RTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVE 388

  Fly   244 VLRSWV 249
            ...:|:
  Fly   389 AYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/264 (30%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 79/264 (30%)
Tryp_SPc 138..397 CDD:238113 79/265 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.