DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG10587

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:240 Identity:70/240 - (29%)
Similarity:111/240 - (46%) Gaps:16/240 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSF-PWQISLQRSGSHSCGGSIYSANIIVTAAHC-LQSVSASVLQVRAGS 87
            |....|:|||..||.:.. .:.|:|:...:..|||::....|::||||| |..|..|......|:
  Fly    40 PGFQTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGA 104

  Fly    88 TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSG 152
            :..:..|:..:|........:..:.|..|:|::||...:. ..|:..:.|.......|....|||
  Fly   105 SKLNDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMK-GKSLGQLILCKKQLMPGTELRVSG 168

  Fly   153 WGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ------------IRNTMICAAASG-KD 204
            ||...:........|:.|.|.:|.:.:|.:|......:            :.::|.||...| ||
  Fly   169 WGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVLGKKD 233

  Fly   205 ACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ||..|||||||....:.|:||:|.|||...|.|||.|:..::.::
  Fly   234 ACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 69/233 (30%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 69/233 (30%)
Tryp_SPc 46..280 CDD:238113 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.