DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Jon74E

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:249 Identity:78/249 - (31%)
Similarity:115/249 - (46%) Gaps:40/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISLQRSGSHS----CGGSIYSANIIVTAAHCLQSVSASVLQVRAGS 87
            :.|||.||.....:.||:|:.|.....:.    ||.|:.|...::|||||::...|        .
  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVA--------I 84

  Fly    88 TYWSSGGVV----AKVSSFKN-----HEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL----AT 139
            ||: .|||:    .::....|     |..:|..::.||||::||........||:.|.|    ::
  Fly    85 TYY-LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSS 148

  Fly   140 YNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICA-AASGK 203
            .|..:...|..||||..:..|::|...|:||...:.|...|   .|.| :.|:.|.||. ...||
  Fly   149 RNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC---EYSY-ANIKPTNICMDTTGGK 209

  Fly   204 DACQGDSGGPLV------SGGVLVGVVSWG--YGCAYSNYPGVYADVAVLRSWV 249
            ..|.||||||||      :..:|:||.|:|  .||. ..||.|:..:.....|:
  Fly   210 STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 76/244 (31%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.