DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG4914

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:251 Identity:81/251 - (32%)
Similarity:117/251 - (46%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAG------ 86
            :.|||||:.|.:|.:||...|.......|||::.:...::|||||::.....:::|..|      
  Fly   125 ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCN 189

  Fly    87 -----STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPAN-- 144
                 .|.:.......|. ||.|.:        ||||::||:..:..:|.|:.|.|.......  
  Fly   190 DKERPETRFVLRAFSQKF-SFSNFD--------NDIALLRLNDRVPITSFIRPICLPRVEQRQDL 245

  Fly   145 --GASAAVSGWGT-QSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICA---AASGK 203
              |..|..:|||| :..|..|  ..||.|.|.::...:|.:.|......|...|:|:   ...|:
  Fly   246 FVGTKAIATGWGTLKEDGKPS--CLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGR 308

  Fly   204 DACQGDSGGPLV------SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTA 253
            |:||||||||||      .....:|:||||.|||..||||||..|.....|:|..:
  Fly   309 DSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/243 (33%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 79/243 (33%)
Tryp_SPc 128..363 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.