DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG4613

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:262 Identity:95/262 - (36%)
Similarity:143/262 - (54%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHC----- 72
            |..|       :|.:: |||||:....:.:||...:.|.....|||::.:...::|||||     
  Fly   127 CTCG-------VPNVN-RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMD 183

  Fly    73 LQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL 137
            ::.||..:||:...||:.   ||...|:....|.||:..::|:|||::||...:....:::...|
  Fly   184 MRGVSVRLLQLDRSSTHL---GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL 245

  Fly   138 ATYNPANG------ASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTM 195
                |:|.      ..|.|:||| :|..||:|  |.||.|.|.|::.:||.:::  |.|.|.:||
  Fly   246 ----PSNWLQNFDFQKAIVAGWGLSQEGGSTS--SVLQEVVVPIITNAQCRATS--YRSMIVDTM 302

  Fly   196 ICAA---ASGKDACQGDSGGPLVSGG---VLVGVVSWGYGCAYSNYPGVYADVAVLRSWV-VSTA 253
            :||.   ..|:|||||||||||:...   .|.||||:|||||..:.||||..|:....|: |:|.
  Fly   303 MCAGYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNTR 367

  Fly   254 NS 255
            :|
  Fly   368 DS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/236 (37%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 88/236 (37%)
Tryp_SPc 137..362 CDD:238113 87/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.