DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG10663

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:251 Identity:74/251 - (29%)
Similarity:109/251 - (43%) Gaps:42/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQIS-LQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGS---TYW 90
            :|:||.|.....:|||:: |.|.....|||::.:...::|||||::    .||.||.|.   .|.
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVR----KVLFVRIGEHNLNYE 566

  Fly    91 SSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATY------------NPA 143
            ....:..:|.....|..::..|:.:|:|::||.         ||::..|:            .|.
  Fly   567 DGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLP---------KAVNATTWIGYSCLPQPFQALPK 622

  Fly   144 NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA-ASGK-DAC 206
            | ....:.|||.:.:..::..|.|....|.|:....|....|.|  .|...|.||. ..|. |.|
  Fly   623 N-VDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDY--TITKNMFCAGHQKGHIDTC 684

  Fly   207 QGDSGGPLVSGG--------VLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTAN 254
            .|||||||:...        .:.|:.|:|.|||..|..|:||.|.....||.|..|
  Fly   685 AGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVN 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 70/244 (29%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 70/244 (29%)
Tryp_SPc 507..735 CDD:238113 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.