DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Jon66Cii

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:87/269 - (32%)
Similarity:121/269 - (44%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTVP----EGLLP----QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI 60
            |.||..||..|.|.|:|    |.|.|    .:.|||..|........|:.:.|..||...|||||
  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSI 69

  Fly    61 YSANIIVTAAHCL---QSVS---ASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAV 119
            .:.:.::||.||:   .||:   .:..:..|..|:|...|...|.||             .|||:
  Fly    70 IAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSS-------------ADIAL 121

  Fly   120 IRLSSSLSFSSSIKAISLATYNPA----NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC 180
            ||: ..:.|...:..:.|.:||..    |...|...|||....| |.:|..||.|::.|:..|:|
  Fly   122 IRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDG-SPLPDYLQCVDLQIIHNSEC 184

  Fly   181 ASSTYGYGSQIRNTMICA-AASGKDACQGDSGGPLVS--GGVLVGVVSWG--YGCAYSNYPGVYA 240
            :    ||...:.:.::|. ...||..|.||||||||:  |..||||.::|  .|| .|..|..:.
  Fly   185 S----GYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGC-QSGAPAGFQ 244

  Fly   241 DVAVLRSWV 249
            .|.....|:
  Fly   245 RVTYHLDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 73/233 (31%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/233 (31%)
Tryp_SPc 40..256 CDD:238113 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.