DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG16998

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:251 Identity:84/251 - (33%)
Similarity:130/251 - (51%) Gaps:12/251 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            :.|:.|:..::|   |.....|.||  .|||||....|...||..|:...|::||..::.::..:
  Fly     1 MNILALILLLIC---GHKTSALSPQ--ERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWL 60

  Fly    67 VTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSS 131
            |||.||:|...:  ..||||||:...||....|.|...|..:|..|:.||||:::|..|.:...:
  Fly    61 VTAGHCVQYPDS--YSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGN 123

  Fly   132 IKAISLATYNPANG---ASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193
            |:.:.|..  |:..   .:..|:|||...:..|....:|:...|.:::|..|..........|.:
  Fly   124 IQVVKLPL--PSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITD 186

  Fly   194 TMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            .|:|||.:|:|.|.||||.|||..|...|:||:.:|||..::||||..:|...:|:
  Fly   187 DMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 76/221 (34%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 76/221 (34%)
Tryp_SPc 25..242 CDD:238113 75/220 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.