DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG32277

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:240 Identity:82/240 - (34%)
Similarity:116/240 - (48%) Gaps:31/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLD---------GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSA 78
            ||.||:         |:|.||..|.:....:.::|:|.|...|||.|.|.|.::||||||:....
  Fly    10 LLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQ 74

  Fly    79 SV--LQVRAGS---------TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSI 132
            .|  |.|.|..         .:..|...|....::....|.:     :|:||||||.....:.:.
  Fly    75 QVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLD-----SDLAVIRLSRPFDIAGNA 134

  Fly   133 KAISLATYN--PANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTM 195
            ..:.: .||  |.: ::..|.|||..:....:....||..||.::|..:|..|......::.|.|
  Fly   135 SLVKI-DYNDLPPH-SNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNM 197

  Fly   196 ICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY 239
            .|| ..:.:||||||||||.:..|..||:|||||||. |.|||||
  Fly   198 FCALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGYPGVY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 77/224 (34%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 77/224 (34%)
Tryp_SPc 27..246 CDD:238113 77/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.