DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and KLK2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:270 Identity:86/270 - (31%)
Similarity:123/270 - (45%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAH 71
            |:.::..::|.|   |.:|.:..|||||......|.|||:::...|...|||.:.....::||||
Human     4 LVLSIALSVGCT---GAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAH 65

  Fly    72 CLQSVSASVLQVRAGSTYW----------SSGGVVAKVSSFKNHEGYNANTM-----------VN 115
            ||          :..|..|          .:|..|....||. |..||.:.:           .:
Human    66 CL----------KKNSQVWLGRHNLFEPEDTGQRVPVSHSFP-HPLYNMSLLKHQSLRPDEDSSH 119

  Fly   116 DIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQC 180
            |:.::|||.....:..:|.:.|.|..||.|.:...||||:........|..||.|:::::|...|
Human   120 DLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMC 184

  Fly   181 ASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADV 242
            |.:   |..::...|:||.  ..|||.|.||||||||..|||.|:.||| ..||....|.||..|
Human   185 ARA---YSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKV 246

  Fly   243 AVLRSWVVST 252
            ...|.|:..|
Human   247 VHYRKWIKDT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/242 (33%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5403
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.