DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and tpr

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:251 Identity:85/251 - (33%)
Similarity:126/251 - (50%) Gaps:26/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCL---- 73
            |..|       :..:..|||||..|.:..:||...|...|...|..|:.:...::||:||:    
  Fly   116 CVCG-------IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFR 173

  Fly    74 -QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL 137
             :.:|..:|:.....::...  :..||:....|..|||....||||:|:|...:.|:..:..:.:
  Fly   174 KERISVRLLEHDRKMSHMQK--IDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM 236

  Fly   138 ATYNPA-NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA-- 199
            .|...: .|.:..|:|||....|..: ...||.|.|.|:||.:|..|.  ||::|.:.|:|..  
  Fly   237 PTPGRSFKGENGIVTGWGALKVGGPT-SDTLQEVQVPILSQDECRKSR--YGNKITDNMLCGGYD 298

  Fly   200 ASGKDACQGDSGGPL--VSGGV----LVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ..|||:|||||||||  |:.|.    :.||||||.|||.:.||||||.|....:|:
  Fly   299 EGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 82/232 (35%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 82/232 (35%)
Tryp_SPc 127..356 CDD:238113 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.