DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss48

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:249 Identity:94/249 - (37%)
Similarity:128/249 - (51%) Gaps:35/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVL-QVRAGS- 87
            |...||||||....:..:|||:||:...:||||||:.|.:.::|||||::....|.| .|..|| 
Mouse    34 PVHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSI 98

  Fly    88 --TYWSSGG--VVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYN-----PA 143
              .|.|:|.  .|::::....|....|     |||:::|||.::|||.|..|.|...:     | 
Mouse    99 DREYSSTGKEYYVSRIAIPDKHRHTEA-----DIALLKLSSRVTFSSVILPICLPNISKQLTVP- 157

  Fly   144 NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYG-------SQIRNTMICAA-- 199
              ||..|:|||....|  ..||.||.:.|.::|...|.......|       ..|:..|.||.  
Mouse   158 --ASCWVTGWGQNQEG--HYPSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGER 218

  Fly   200 ASGKDACQGDSGGPLVS--GGV--LVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            .|.||:|:|||||||..  .||  |:||||||..|. .:.||||.:|...:.|:
Mouse   219 QSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWGLECG-KDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 91/242 (38%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 91/242 (38%)
Tryp_SPc 40..274 CDD:238113 91/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.