DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG8299

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:262 Identity:96/262 - (36%)
Similarity:137/262 - (52%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSG---SHSCGGSIYSA 63
            |.:|||..:.              .:...||||....|:.||:|:|::...   .|.||||||:.
  Fly    13 LGVVILTDSA--------------SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAP 63

  Fly    64 NIIVTAAHCLQSVSASVLQVRAGSTY---WSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSS 125
            .:::|||||::...||.:::.||...   ....||  |||....|.|||..|.||||.:|.....
  Fly    64 RVVITAAHCIKGRYASYIRIVAGQNSIADLEEQGV--KVSKLIPHAGYNKKTYVNDIGLIITREP 126

  Fly   126 LSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            |.:|:.::.|::|...|.:||.|.|||||.::....::|:.|:.|.:.|:.:|.|.:........
  Fly   127 LEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYT 191

  Fly   191 IRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTA 253
            :.:.|:||.  ..|||.|.|||||||...||||||||||.||....:||||..|.....|:...|
  Fly   192 VTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQA 256

  Fly   254 NS 255
            .:
  Fly   257 EA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 90/226 (40%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 90/226 (40%)
Tryp_SPc 28..255 CDD:238113 91/228 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.