DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and iotaTry

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:252 Identity:114/252 - (45%)
Similarity:164/252 - (65%) Gaps:6/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAA 70
            |:.:.:|..|.|...:   .:..|||:|||...|.:.|||:|:|.|..|.|||.|||..||:||.
  Fly     6 IVATVLVLLLLGDASD---VEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAG 67

  Fly    71 HCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAI 135
            |||...|.::::||.|:...:.||.:..|:::|.||.:::..:..||||:|||:.|:|..|.:||
  Fly    68 HCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAI 132

  Fly   136 SLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ-IRNTMICAA 199
            :||:.:|:.|.:..|:|||...:|:.|  ..||...:.|:.:.:|||..:|||:. :....||||
  Fly   133 NLASTSPSGGTTVTVTGWGHTDNGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEETICAA 195

  Fly   200 ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTANSI 256
            ::..|||.||||||||:...|||:|||||.||..||||||||||:||.|:|..||:|
  Fly   196 STDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAANAI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 104/219 (47%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 104/219 (47%)
Tryp_SPc 28..247 CDD:238113 104/220 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443169
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm49678
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.900

Return to query results.
Submit another query.