DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and zetaTry

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:269 Identity:119/269 - (44%)
Similarity:149/269 - (55%) Gaps:24/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTVPEGLLPQL------DGRIVGGSATTISSFPWQISLQRSG--------SH 54
            ||.||:.:|..:..|....||..|      |||||||.||.|:..|:||||:..|        .|
  Fly     6 IVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70

  Fly    55 SCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWS-SGGVVAKVSSFKNHEGYNANTMV-NDI 117
            .|||||::...|||||||:....||..:|.||:.:.: |.||:..|.....||||.:.... |||
  Fly    71 RCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDI 135

  Fly   118 AVIRLSSSLSFSS-SIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCA 181
            |::.:...|..:: :||||.||...|..|..:.||||||.|.|..| .:||..|:|.|||...|.
  Fly   136 AILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS-SNQLLAVDVPIVSNELCD 199

  Fly   182 SSTYGYGSQ---IRNTMICA---AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA 240
            .....:|.:   |.:.|:||   ...|.|||||||||||.....|.||||||..||..|||||||
  Fly   200 QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYA 264

  Fly   241 DVAVLRSWV 249
            :||.||.|:
  Fly   265 NVAYLRPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 107/235 (46%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 107/235 (46%)
Tryp_SPc 39..276 CDD:238113 107/236 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443239
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.