DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG8170

DIOPT Version :10

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:102 Identity:23/102 - (22%)
Similarity:40/102 - (39%) Gaps:16/102 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STVSEMP-------AASEEISDET----VRELLGMSEEDFNYLLNEISGKISRRD-TFMRK---- 52
            :|..:.|       .|...|.::|    |.||...::....|.|...||...::. |.|.|    
  Fly   400 TTAGQQPQSPTDSIEALANIKEKTTMCLVNELARYNKIQHQYRLTGESGPAHKKHFTVMLKLGDE 464

  Fly    53 AFTAKERLIVTLRFLATGESFMALASLYDISASSIRT 89
            .:||:...|...:..|.|::..|....:..:.::.||
  Fly   465 EYTAEGASIKKAQHKAAGDAIAATKYKHPPARTNRRT 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 15/65 (23%)
CG8170NP_610441.2 Tryp_SPc 612..846 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.