DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Jon44E

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:274 Identity:80/274 - (29%)
Similarity:124/274 - (45%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGL--------LP---QLDGRIVGGSATTISSFPWQISLQ-RSGSH 54
            :|:.:.|:.:..|..|.||...        :|   :::|||..|........|:.:.|. ..|.:
  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGY 65

  Fly    55 SCGGSIYSANIIVTAAHCLQSVS------ASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTM 113
            .|||||.....::|||||..|.:      .:..:..|..|:|.|.      |....|..:| :.:
  Fly    66 WCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSR------SDMIQHPDWN-DFL 123

  Fly   114 VNDIAVIRLSSSLSFSSSIKAISLATYNPA----NGASAAVSGWGTQSSGSSSIPSQLQYVNVNI 174
            .||||:||: ..:.|.|.:..:.|.:||..    :|..|..||||. :..:|.:.:.|..|:|.|
  Fly   124 NNDIALIRI-PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGL-TDNNSGMSNYLNCVDVQI 186

  Fly   175 VSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLV--SGGVLVGVVSW--GYGCAYSNY 235
            :..:.| .:.||......||:......||.:|.||||||||  ....:||:||:  |.||. :..
  Fly   187 IDNNDC-RNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSFGSGEGCT-AGR 249

  Fly   236 PGVYADVAVLRSWV 249
            |..:..|.....|:
  Fly   250 PAGFTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 71/233 (30%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/233 (30%)
Tryp_SPc 41..266 CDD:238113 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.