DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and KLK3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:262 Identity:83/262 - (31%)
Similarity:123/262 - (46%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            |:.|:..|..:|..      |.:..|||||......|.|||:.:...|...|||.:.....::||
Human     5 VVFLTLSVTWIGAA------PLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTA 63

  Fly    70 AHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVN-----------DIAVIRLS 123
            |||:::.|. :|..|....:....|.|.:||....|..|:.:.:.|           |:.::|||
Human    64 AHCIRNKSV-ILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLS 127

  Fly   124 SSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYG 188
            .....:.::|.:.|.|..||.|.:...||||:........|.:||.|:::::|...||..   :.
Human   128 EPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQV---HP 189

  Fly   189 SQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVV 250
            .::...|:||.  ..||..|.||||||||..|||.|:.||| ..||....|.:|..|...|.|:.
Human   190 QKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIK 254

  Fly   251 ST 252
            .|
Human   255 DT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 76/232 (33%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.