DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Send2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:254 Identity:109/254 - (42%)
Similarity:141/254 - (55%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTV--PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVT 68
            :||.|:.....|.|  ||       .||:||....|...|||:|:||.|.|.||||||||:||:|
  Fly     7 LLLLALNSLSAGPVIRPE-------ERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIIT 64

  Fly    69 AAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIK 133
            ||||:|...   .||||||...:|.|.|..|::.:.|||     :.||||::|||..|.|::.::
  Fly    65 AAHCVQGQG---YQVRAGSALKNSNGSVVDVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQVQ 121

  Fly   134 AISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICA 198
            .|.||..||..|:.|.|||||  ||...|.|..||.||:.|.....|..:        ..:.|||
  Fly   122 PIPLAKTNPPPGSIAFVSGWG--SSSYYSHPIDLQGVNLYIQWPYYCGLT--------EPSRICA 176

  Fly   199 AASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVSTANSI 256
            .:.|:.||:||||||||....||||||.| ..|.||:   :|..|...|.|:::..:.|
  Fly   177 GSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYFREWILNAIDEI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 100/219 (46%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 100/219 (46%)
Tryp_SPc 27..225 CDD:238113 99/218 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.