DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and l(2)k05911

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:264 Identity:96/264 - (36%)
Similarity:137/264 - (51%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGGTVPEGLLPQLDG---------RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAA 70
            :.||..|||..|...         |||||...:...|||...|.:||...||||:.:.:.|:|||
  Fly   375 VSGTSSEGLPLQCGNKNPVTPDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAA 439

  Fly    71 HC---LQSVSASVLQVRAG----STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSF 128
            ||   :.|...:.|....|    .|.:....|..::.....|:|:..:|:.||:|::.||..:.|
  Fly   440 HCVARMTSWDVAALTAHLGDYNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPF 504

  Fly   129 SSSIKAISLATYNPA------NGASAAVSGWGT-QSSGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            :..|:.|.|.| :|:      :|..|.|:|||: :.:|..  ||.||.|::.|.:.::||.. ||
  Fly   505 TREIQPICLPT-SPSQQSRSYSGQVATVAGWGSLRENGPQ--PSILQKVDIPIWTNAECARK-YG 565

  Fly   187 YGSQ--IRNTMICAAASGKDACQGDSGGPLV--SGG--VLVGVVSWGYGCAYSNYPGVYADVAVL 245
            ..:.  |..:||||..:.||:|.||||||:|  .||  ..||:||||.||....|||||..|..|
  Fly   566 RAAPGGIIESMICAGQAAKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSL 630

  Fly   246 RSWV 249
            ..|:
  Fly   631 LPWI 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 89/238 (37%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 89/238 (37%)
Tryp_SPc 400..637 CDD:238113 89/239 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.