DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Phae2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:90/269 - (33%)
Similarity:140/269 - (52%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGL-LPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANI 65
            |..::||:  ||...|:   || |.|.:||:|||.|...:|.|:.:|:|..|:|.|..:|.::|.
  Fly     7 LATILLLA--VCVSQGS---GLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNW 66

  Fly    66 IVTAAHCLQSVSASVLQVRAGSTYWSSGGVVA---------KVSSFKNHEGYNANTMVNDIAVIR 121
            :|||||||    |:..|| .|||..:....||         :::.:..::.|...|:..||.:|.
  Fly    67 LVTAAHCL----ANRNQV-LGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIY 126

  Fly   122 LSSSLSFSSSIKAISLATYNPANG----ASAAVSGWG-TQSSGSSSIPSQLQYV-NVNIVSQSQC 180
            ..::.::::::..:.|    |::|    ..|.:.||| |..:.|.|.|..||.. |:.|:|...|
  Fly   127 TPTAFTWTAAVAPVKL----PSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSC 187

  Fly   181 ASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADV 242
            |::....|..:..|.:|..  ..|...|..|||||||.|.||:|:|||| ..|...|.|.||..|
  Fly   188 AAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQV 252

  Fly   243 AVLRSWVVS 251
            :...:|:.:
  Fly   253 SSFITWIAA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 78/236 (33%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 78/236 (33%)
Tryp_SPc 32..262 CDD:238113 78/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.