DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and PRSS48

DIOPT Version :10

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001340540.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:346 Species:Homo sapiens


Alignment Length:39 Identity:14/39 - (35%)
Similarity:17/39 - (43%) Gaps:11/39 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KAFTAKERLIVTLRFLATGE----------SFMALASLY 80
            |:|..|..|:|..| :.|||          ||....|||
Human   429 KSFRLKSFLVVHQR-IHTGEKPFACDTCGKSFKQRTSLY 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 14/39 (36%)
PRSS48NP_001340540.1 Tryp_SPc 28..265 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.