DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and OVCH2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:299 Identity:85/299 - (28%)
Similarity:133/299 - (44%) Gaps:50/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIVILLSAVVCALGGTVPEGLLPQ------------------LDGRIVGGSATTISSFPWQISLQ 49
            |:::||..|....|.:.... ||:                  :..||:|||.....|:|||:||:
Human    11 KLILLLGIVFFERGKSATLS-LPKAPSCGQSLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSLK 74

  Fly    50 RSGSHSCGGSIYSANIIVTAAHCLQSVS-ASVLQVRAGS---TYWSSGGVVAKVSSFKNHEGYNA 110
            :...|.|||||.|...::|||||:.:.: .|.|.|.||.   :....|.....:.:...|..::.
Human    75 QRQKHICGGSIVSPQWVITAAHCIANRNIVSTLNVTAGEYDLSQTDPGEQTLTIETVIIHPHFST 139

  Fly   111 -NTMVNDIAVIRLSSSLSFSSSIKAISLATYNP--ANGASAAVSGWGTQSSGSSSIPSQ-LQYVN 171
             ..|..|||:::::.:..|...:..|.|.....  ..|.....:|||..:.|  .:.|| ||.||
Human   140 KKPMDYDIALLKMAGAFQFGHFVGPICLPELREQFEAGFICTTAGWGRLTEG--GVLSQVLQEVN 202

  Fly   172 VNIVSQSQCASSTYGYGSQIR-NTMICAA--ASGKDACQGDSGGPLV-----SGGVLVGVVSWGY 228
            :.|::..:|.::.......|. .|.:|..  ..|:|||||||||.|:     ....|.||.|||.
Human   203 LPILTWEECVAALLTLKRPISGKTFLCTGFPDGGRDACQGDSGGSLMCRNKKGAWTLAGVTSWGL 267

  Fly   229 GC----------AYSNYPGVYADVAVLRSWV---VSTAN 254
            ||          :....||::.|::.:..|:   :.|.|
Human   268 GCGRGWRNNVRKSDQGSPGIFTDISKVLPWIHEHIQTGN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/244 (31%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 75/244 (31%)
Tryp_SPc 56..301 CDD:238113 75/246 (30%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.