DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TMPRSS11A

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_872412.3 Gene:TMPRSS11A / 339967 HGNCID:27954 Length:421 Species:Homo sapiens


Alignment Length:240 Identity:82/240 - (34%)
Similarity:119/240 - (49%) Gaps:15/240 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGS 87
            ::|....||..|.....:::|||.|||....|.||.::.|...:||||||.|..........:..
Human   182 VVPLNVNRIASGVIAPKAAWPWQASLQYDNIHQCGATLISNTWLVTAAHCFQKYKNPHQWTVSFG 246

  Fly    88 TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL----ATYNPANGASA 148
            |..:...:...|..|..||.|.:.....||||:::||.::||..|:.|.|    |::.|  ..:.
Human   247 TKINPPLMKRNVRRFIIHEKYRSAAREYDIAVVQVSSRVTFSDDIRQICLPEASASFQP--NLTV 309

  Fly   149 AVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA-ASG-KDACQGDSG 211
            .::|:|....|..| .:.|:...|.|:|...|..... ||:.|:..|.||. ..| .|||:||||
Human   310 HITGFGALYYGGES-QNDLREARVKIISDDVCKQPQV-YGNDIKPGMFCAGYMEGIYDACRGDSG 372

  Fly   212 GPLVSGGV-----LVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS 251
            ||||:..:     |:|:||||..|...:.||||..|...|:|:.|
Human   373 GPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIAS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/229 (34%)
TMPRSS11ANP_872412.3 SEA 49..147 CDD:279699
Tryp_SPc 189..415 CDD:214473 79/229 (34%)
Tryp_SPc 190..418 CDD:238113 80/232 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.