DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and PRSS38

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:283 Identity:91/283 - (32%)
Similarity:139/283 - (49%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAV----VCALGGTVPE--GL---------LPQLDGRIVGGSATTISSFPWQISLQRS 51
            |.:::||..|    |.||....||  |:         .|.::|:|:||.......:|||:|:..:
Human    16 LGLLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERKWPWQVSVHYA 80

  Fly    52 GSHSCGGSIYSANIIVTAAHCLQS----------VSASVLQVRAGSTYWSSGGVVAKVSSFKNHE 106
            |.|.|||||.:...:::||||...          |....|:|....|.|..   |.:|.....:|
Human    81 GLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNLRVAGNHTQWYE---VNRVILHPTYE 142

  Fly   107 GYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNP---ANGASAAVSGWGTQS-SGSSSIPSQL 167
            .|  :.:..|:|:::|.:.:.||.|:..:.|||  |   ...|:...:|||..| .|.:|  .:|
Human   143 MY--HPIGGDVALVQLKTRIVFSESVLPVCLAT--PEVNLTSANCWATGWGLVSKQGETS--DEL 201

  Fly   168 QYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSW 226
            |.:.:.::.:..| ...||:.|.|...|:||.  .:.|..|:||||||||    ...:.:|:|||
Human   202 QEMQLPLILEPWC-HLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSW 265

  Fly   227 GYGCAYSNYPGVYADVAVLRSWV 249
            |.||:...||||||.|:....|:
Human   266 GRGCSNPLYPGVYASVSYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 78/238 (33%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.