DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG3355

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:236 Identity:90/236 - (38%)
Similarity:132/236 - (55%) Gaps:24/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSH----SCGGSIYSANIIVTAAHCL----QSVSASVLQVRAG 86
            |||||.....:.:||...|.: |.|    .||||:.:...::|||||:    ..::..:||:...
  Fly    75 RIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRS 138

  Fly    87 STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL--ATYNPANGASAA 149
            |   ...|:|.||.....|..|:.|.:|||:|:::|.|.:..:.:::.:.|  |.:| .:|.:|.
  Fly   139 S---RDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHN-FDGKTAV 199

  Fly   150 VSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA---ASGKDACQGDSG 211
            |:|||....|..: .:.||.|||.:::.:||..:.  |..:|...|:||.   ..||||||||||
  Fly   200 VAGWGLIKEGGVT-SNYLQEVNVPVITNAQCRQTR--YKDKIAEVMLCAGLVQQGGKDACQGDSG 261

  Fly   212 GPL-VSGG--VLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ||| |:.|  .|.||||:|||||..|.|||||.|:....|:
  Fly   262 GPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 89/234 (38%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 89/234 (38%)
Tryp_SPc 76..305 CDD:238113 89/235 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.