DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG31954

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:267 Identity:109/267 - (40%)
Similarity:150/267 - (56%) Gaps:22/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTV------------PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS 53
            :|:..:|:.|.||.:...|            |..|.|:||||||||....|:..|.|:|||.| |
  Fly     9 LLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTS-S 72

  Fly    54 HSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIA 118
            |.|||||.|...|:|||||....:|..|:||.|::.::..|.:.:|.....|..:|...:..|.:
  Fly    73 HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFS 137

  Fly   119 VIRLSSSLSFSSSIKAISL--ATYNPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQC 180
            :::|:..:.|..:.||:.|  :.....:|.:..||||| ||:...|.  ..|:.|.|.:|:|..|
  Fly   138 LLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESR--EWLRQVEVPLVNQELC 200

  Fly   181 ASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVS-GGVLVGVVSWGYGCAYSNYPGVYADV 242
            :.....||. :...||||.  ..||||||||||||:|| .|.||||||||||||..:|||||:.|
  Fly   201 SEKYKQYGG-VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRV 264

  Fly   243 AVLRSWV 249
            :..|.|:
  Fly   265 SFARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 96/224 (43%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 96/224 (43%)
Tryp_SPc 51..274 CDD:238113 96/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443312
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.