DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG11911

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:128/270 - (47%) Gaps:23/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPE---GLLPQL-DGRIVGGSATTISSFPWQISLQRS---GSHSCGG 58
            ::.:.::::.|..|.|..:.:   .|:|.. .|.::.|:.....|.|:.:||..:   .||.|||
  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67

  Fly    59 SIYSANIIVTAAHCL-QSVSASV---LQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAV 119
            ::.:.:.|||||||: :.|..|:   |..||.....:.   ..:|...:.||.|.......|||:
  Fly    68 TLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQ---QRQVDFGRVHEKYTGGVGPYDIAL 129

  Fly   120 IRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASST 184
            :.::.|..|:..::..:|.:....:.....:.|||...|...|....||.|...|::..:| ...
  Fly   130 LHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEEC-KEE 193

  Fly   185 YGYGSQIRNTMICAAA--SGKDACQGDSGGPLV-----SGGVLVGVVSWGY-GCAYSNYPGVYAD 241
            ....:.|..:.||:::  ..|.||.||||||||     :...|:|:||||| .|..:|.|.:|..
  Fly   194 LPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTK 258

  Fly   242 VAVLRSWVVS 251
            |:....|:.:
  Fly   259 VSAYIDWITN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 68/233 (29%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 69/236 (29%)
Tryp_SPc 37..266 CDD:214473 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.