DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:232 Identity:85/232 - (36%)
Similarity:127/232 - (54%) Gaps:10/232 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGV 95
            ||||....|...|:|:|::....|.|||||.:...::||.||:....|:.:.||.||.:::.||.
Mosquito    47 IVGGHVVDIEMHPYQVSVRELNEHICGGSIITNRWVLTAGHCVDDTIAAYMNVRVGSAFYAKGGT 111

  Fly    96 VAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLA--TYNPANGASAAVSGWGTQSS 158
            :..|.|...|..:...:.:.|.|:::|..::.||:..:.|:||  ..|..:.....|:|||...:
Mosquito   112 IHPVDSVTTHPDHVPYSWLADFALLQLKHAIVFSTIAQPIALAFRLDNALSDRECVVTGWGRTLN 176

  Fly   159 GSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICA---AASGKDACQGDSGGPLVSGGVL 220
            ...|. .:|:.|.:.:||:..|.::   |..:|..|||||   ...||.:|..|||||||.|.:.
Mosquito   177 EEESF-DKLRAVQIPLVSRVLCNAT---YEGKIDQTMICAGDFVDGGKGSCAYDSGGPLVCGDMQ 237

  Fly   221 VGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTA-NSI 256
            ||:||||.|||...||.||:.|...|:|:.|.. |||
Mosquito   238 VGIVSWGKGCAMPGYPDVYSSVLYARAWINSIVHNSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 80/222 (36%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 81/225 (36%)
Tryp_SPc 47..266 CDD:214473 80/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.