DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:265 Identity:81/265 - (30%)
Similarity:128/265 - (48%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLD------GRIVGGSATTISSFPWQISLQRSGSHSCGGS 59
            :|:.|.||:.|:.|:...:......|.:      ..||||....|...|:|.::...|...||||
Mosquito     3 VLRQVGLLAVVLAAISLPISSAQQQQEERDDSATNMIVGGMKVDIEQVPYQAAILTLGQVHCGGS 67

  Fly    60 IYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSS 124
            |.....::||.||:..:..:..:|..|||....|..:.....|...|..:....  |||:.:|:.
Mosquito    68 IIGPRWVLTAYHCVDWLLPNFYEVAVGSTNPYEGQRILVQELFVPLETLSDPNF--DIALAKLAH 130

  Fly   125 SLSFSSSIKAISLATYNPA--NGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            :|.:||:::.|.|.|.:.:  ....|.:||:| |:...|.:|   |:...:.::....|..:   
Mosquito   131 TLQYSSTVQCIPLLTSDSSLIPDTPAYISGFGYTKERASDNI---LKAAQIKVLPWDYCQQA--- 189

  Fly   187 YGSQIRNTMICAA-ASGK-DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |...:|..|:||. ..|| |:|||||||||:....|.|||.:|.|||..::||||..|.....|:
Mosquito   190 YPYLMREFMLCAGFKEGKVDSCQGDSGGPLIVNAKLAGVVFYGEGCARPHFPGVYISVPWFSDWI 254

  Fly   250 VSTAN 254
            :...:
Mosquito   255 IEVVD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 73/223 (33%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 74/225 (33%)
Tryp_SPc 39..254 CDD:214473 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.