DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP011920

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_552320.3 Gene:AgaP_AGAP011920 / 3291457 VectorBaseID:AGAP011920 Length:169 Species:Anopheles gambiae


Alignment Length:176 Identity:62/176 - (35%)
Similarity:106/176 - (60%) Gaps:14/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVC----ALGGTV-PEGLLPQLDGRIVGGSATTISSFPWQISLQRSG-SHSCGGS 59
            |.::.:||:  :|    |||..: ||  ..:..||||||.....:.||:|:||:.|| ||.||||
Mosquito     1 MFRLSVLLT--ICLAATALGNVLSPE--YYEWAGRIVGGQNAGTNQFPYQVSLRSSGNSHFCGGS 61

  Fly    60 IYSANIIVTAAHC-LQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLS 123
            |.:...:::|||| :...:|:.:.| .|:.:.:.||:....:...||..|||||:.||:::::.:
Mosquito    62 IINNRYVLSAAHCTIGRTTANTISV-VGAIFLNGGGIAHSTARIVNHPSYNANTLANDVSLVQTA 125

  Fly   124 SSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQY 169
            :.::::::::.|:|.| |...|..|..|||| |...:..||:.||:
Mosquito   126 TFITYTAAVQPIALGT-NFVTGGGAVASGWG-QLGANIGIPNHLQF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 52/142 (37%)
AgaP_AGAP011920XP_552320.3 Tryp_SPc 31..>168 CDD:214473 50/139 (36%)
Tryp_SPc 32..>168 CDD:238113 49/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.