DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP001252

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_321900.3 Gene:AgaP_AGAP001252 / 3290448 VectorBaseID:AGAP001252 Length:271 Species:Anopheles gambiae


Alignment Length:243 Identity:77/243 - (31%)
Similarity:118/243 - (48%) Gaps:14/243 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVPEGLL--------PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYS 62
            :|...||.|:.|   ||:|        .:..||||||....|..||:|:||:..|.|.||.|..:
Mosquito     5 LLQLIVVAAIAG---EGVLGREAAPAPARATGRIVGGWEVYIGQFPYQLSLEYDGYHICGASAVA 66

  Fly    63 ANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            ..:.:||.||....:.:.|.||.||:....||:|..|.....|..|:.:.:..|:.|:|:..:..
Mosquito    67 PRLALTAGHCCIGTNETDLTVRGGSSTLEEGGIVFPVKKLVIHPDYDDSNLDFDVCVLRIGGTFQ 131

  Fly   128 FSSSIKAIS-LATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            ..|:|..|. .::....:|..|.|:|||...|..:.:|: |:.:.|.:.|...|......|.:. 
Mosquito   132 NKSNIGIIQPTSSGTIPSGELAIVTGWGATESNGNFVPN-LRSLAVKVWSTKNCTDQAANYMTS- 194

  Fly   192 RNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY 239
            ..:|:||.:.|:..|.||||||||.....:|:||:.........|.:|
Mosquito   195 SGSMMCAGSVGRSFCVGDSGGPLVYDQRQIGIVSFLINECGGTAPAIY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 68/211 (32%)
AgaP_AGAP001252XP_321900.3 Tryp_SPc 34..254 CDD:214473 68/211 (32%)
Tryp_SPc 35..257 CDD:238113 67/210 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.