DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP005689

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_556335.3 Gene:AgaP_AGAP005689 / 3290022 VectorBaseID:AGAP005689 Length:300 Species:Anopheles gambiae


Alignment Length:257 Identity:84/257 - (32%)
Similarity:133/257 - (51%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISL---QRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWS 91
            ||..|...|...||:||:|   ..||:..||||:.:.|.|:|||||:.|          |::..:
Mosquito    55 RITNGQEATPGQFPFQIALISEFASGNGLCGGSVLTRNFILTAAHCVVS----------GASTLA 109

  Fly    92 SGGVVA------------------KVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL- 137
            ||||..                  ..|..:.|..|:::|:.||||.:||:|.::|::.|:.|.| 
Mosquito   110 SGGVAIMGAHNRNIQESTQQRIRFATSGIRRHPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRLP 174

  Fly   138 --ATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMIC-AA 199
              :......|.:..|||:|..|..||:..:.:::....:::.:.|.:.   :||.:.|..:| :.
Mosquito   175 GRSDTRQFGGFTGTVSGFGRTSDASSATSAVVRFTTNPVMTNTDCIAR---WGSTVVNQHVCLSG 236

  Fly   200 ASGKDACQGDSGGPLV--SGGVL-VGVVSWG--YGCAYSNYPGVYADVAVLRSWVVSTANSI 256
            |.|:.:|.|||||||.  |||.: :||||:|  .|||. ..|.|||.|.....|:|:.::.:
Mosquito   237 AGGRSSCNGDSGGPLTVQSGGTMQIGVVSFGSVNGCAI-GMPSVYARVTFFLDWIVANSDFV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 82/248 (33%)
AgaP_AGAP005689XP_556335.3 Tryp_SPc 55..290 CDD:214473 82/248 (33%)
Tryp_SPc 56..290 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.