DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss34

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:276 Identity:88/276 - (31%)
Similarity:134/276 - (48%) Gaps:38/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVP--------EGLLPQLDGRIVGGSATTISSFPWQISLQ------RSGSHSC 56
            :|..::.| ||.|:|        :||:     .||||...:.|.||||:||:      ....|.|
Mouse     8 LLFLSLPC-LGNTMPLTLDLGSGQGLV-----GIVGGCPVSASRFPWQVSLRLYDMEHSRWEHEC 66

  Fly    57 GGSIYSANIIVTAAHCL--QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVN---D 116
            |||:.....::|||||:  :.|.|..::|:.|.........:.||.....|..::......   |
Mouse    67 GGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGAD 131

  Fly   117 IAVIRLSSSLSFSSSIKAISL--ATYNPANGASAAVSGWGT-QSSGSSSIPSQLQYVNVNIVSQS 178
            ||:::|.:.:..|..:..:||  |:...::..:..|:|||. ::......|..|:.|.|.||..:
Mouse   132 IALLKLDTRVVLSEHVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENN 196

  Fly   179 QCA------SSTYGYGSQIRNTMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYS 233
            .|.      ||:......|::.|:||...|:|:|:.|||||||    ...|.|||||||.||...
Mouse   197 DCEQKYQTNSSSDSTTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLP 261

  Fly   234 NYPGVYADVAVLRSWV 249
            ::||||..|....||:
Mouse   262 DFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/242 (33%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 80/243 (33%)
Tryp_SPc 35..277 CDD:214473 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.