DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and tmprss4b

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:239 Identity:92/239 - (38%)
Similarity:125/239 - (52%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCL----QSVS--------ASV 80
            :.|||||..|:|..:|||:|||.:..|.||||:.|.:.|::||||.    |.:|        ..|
Zfish   199 EDRIVGGVETSIEHWPWQVSLQFNHRHMCGGSLLSTSWIISAAHCFTGRTQELSRWTVVLGQTKV 263

  Fly    81 LQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANG 145
            :.|           |...|.....|:.||..|...|||:::|:..:....||..:.|..:..|..
Zfish   264 MDV-----------VGVSVDMIVIHKDYNRLTNDFDIAMLKLTWPVKTGESILPVCLPPHQLAIK 317

  Fly   146 ASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQG 208
            ....|:|||....| .::|:.||..:|.:|::|:|:..|. |.|.|...|:||.  ....|||||
Zfish   318 DMLVVTGWGLLKEG-GALPTVLQKASVPLVNRSECSKPTI-YSSSITPRMLCAGFLQGNVDACQG 380

  Fly   209 DSGGPLV---SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |||||||   |...|:|:||||.|||....|||||||..|..|:
Zfish   381 DSGGPLVYLSSRWQLIGIVSWGVGCAREGKPGVYADVTQLLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 91/235 (39%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133
SRCR 105..>175 CDD:278931
Tryp_SPc 201..424 CDD:214473 91/235 (39%)
Tryp_SPc 202..427 CDD:238113 91/236 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.